SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|23099474|ref|NP_692940.1| from Oceanobacillus iheyensis HTE831

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|23099474|ref|NP_692940.1|
Domain Number 1 Region: 114-296,425-585
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.87e-108
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000658
Further Details:      
 
Domain Number 2 Region: 293-420
Classification Level Classification E-value
Superfamily GAD domain-like 9.32e-42
Family GAD domain 0.00012
Further Details:      
 
Domain Number 3 Region: 5-107
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.52e-30
Family Anticodon-binding domain 0.0000962
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|23099474|ref|NP_692940.1|
Sequence length 591
Comment aspartyl-tRNA synthetase [Oceanobacillus iheyensis HTE831]
Sequence
MSERLMAGRLNEKNIGEKVLLKGWVQKRRDLGGLIFIDLRDKSGLIQVVFNPDHSKKALE
TAENIRSEYVIEINGTVVARDEATINPSMKTGKIEVNASSVQILNKAKTPPFTIQDETDV
SEDVRLKYRYLDLRRNSLQETFRLRHQTTQSIRNYLNDKDFLEMETPILTKSTPEGARDY
LVPSRVHPGEFYALPQSPQLFKQLIMMGGFERYYQIARCFRDEDLRADRQPEFTQIDIET
SFLTSDEIMDMTEHMMKKVMKEVKDIDISLPLPRMPYQEAMDRYGSDKPDTRFDLELIHV
SDIVASSGFKVFSQAVDNGGKVALLNIKGKADNYSRKDIDKLTEYVKVYDAKGLAWLKAD
ESELKGPIAKFLSEEEVAGIRDRANVEQGDLLLFVADKTNVVYDSLGALRLYLGKELGLI
DESKFHFLWVTDWPLLEYDEGLGRYFAAHHPFTSAIEEDLDKLETDPASVRANAYDLVLN
GFELGGGSIRIHQKEQQDQMFKVLGFSEEEARSQFGFLLDALEYGAPPHGGIALGLDRII
MLLAGRSNLRDTILFPKTASASDLMTAAPSGVSDDQLQELSIQLQSGEKNQ
Download sequence
Identical sequences Q8EPS0
221109.OB2019 gi|23099474|ref|NP_692940.1| WP_011066415.1.3139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]