SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|23099525|ref|NP_692991.1| from Oceanobacillus iheyensis HTE831

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|23099525|ref|NP_692991.1|
Domain Number 1 Region: 1-158
Classification Level Classification E-value
Superfamily Glutamyl tRNA-reductase catalytic, N-terminal domain 5.62e-46
Family Glutamyl tRNA-reductase catalytic, N-terminal domain 0.00044
Further Details:      
 
Domain Number 2 Region: 163-315
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 4.97e-38
Family Aminoacid dehydrogenase-like, C-terminal domain 0.00046
Further Details:      
 
Domain Number 3 Region: 317-420
Classification Level Classification E-value
Superfamily Glutamyl tRNA-reductase dimerization domain 6.67e-19
Family Glutamyl tRNA-reductase dimerization domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|23099525|ref|NP_692991.1|
Sequence length 457
Comment glutamyl-tRNA reductase [Oceanobacillus iheyensis HTE831]
Sequence
MHILKVGFNYKTTPVDIREKFTFSEDSLQDAMVELKNQKSILEDVIISTCNRTEIYAVVD
QLHTGRYYIKQFLSNWFGIEKEEFSTYLRITEDDGAMEHLFRVSTGLDSMVLGETQILGQ
VKQAFLNSQQVNTTGTIFNELFKQAITFGKRAHKETAIGEHAVSISYAAVELAKKIFGDL
QEKHVAILGAGKMGELAAKNIQGSGATKITVVNRTLENANEMAEKFNADVESIDQLPVIL
QQADILISSTGADSIVVTKEMMEKVQKQRKGRALFLVDIAVPRDMDPAISELENVFLYDI
DNLQHIVDDNLESRKQAAEKIELLIEEEIVTFKEWLKTLGVIPVISALRQKALTIQAETM
QSIERKIPNLTDRERKVLNKHTKSIINQLLKEPVTQAKEFAGKDNAEDSLQLFINIFGIE
EEVKEELVKHAKKNETLMKIAKEEPSSFPIIEKITTA
Download sequence
Identical sequences Q8EPM7
WP_011066465.1.3139 221109.OB2070 gi|23099525|ref|NP_692991.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]