SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|23099963|ref|NP_693429.1| from Oceanobacillus iheyensis HTE831

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|23099963|ref|NP_693429.1|
Domain Number 1 Region: 2-133
Classification Level Classification E-value
Superfamily FlgN-like 0.000000000000745
Family FlgN-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|23099963|ref|NP_693429.1|
Sequence length 160
Comment hypothetical protein OB2508 [Oceanobacillus iheyensis HTE831]
Sequence
MSEKIISKINKLLELHQEILELSKKKTIEIKDGHVNALQTLLAKERKLARQLQQCEEERM
QVVQEWSAEHRLAKTNPTISEIIDYIAEDKQKQLLTIATSLTDTIKELKKQEQLNQVLLN
ESMKFVQLSLDLMNPTIKTMNYGSEKGMNEASRSVFDSKA
Download sequence
Identical sequences Q8ENH5
221109.OB2508 WP_011066901.1.3139 gi|23099963|ref|NP_693429.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]