SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|23100217|ref|NP_693684.1| from Oceanobacillus iheyensis HTE831

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|23100217|ref|NP_693684.1|
Domain Number 1 Region: 1-101
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 1.44e-35
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|23100217|ref|NP_693684.1|
Sequence length 103
Comment PTS system cellobiose-specific transsporter subunit IIA [Oceanobacillus iheyensis HTE831]
Sequence
MNQTQLTETAFQIILFAGNGKSSAMEAIHAAKEGNFAVADDLIKTASDELTNAHNFQTKL
LHDEANGDKKDINLILIHSQDHLMNAMTIKDLAIEIIDIYRNK
Download sequence
Identical sequences Q8EMS9
WP_011067156.1.3139 221109.OB2762 gi|23100217|ref|NP_693684.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]