SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5030366|Sb01g044910 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5030366|Sb01g044910
Domain Number 1 Region: 132-229
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.96e-21
Family B3 DNA binding domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5030366|Sb01g044910
Sequence length 239
Sequence
MVTAAAETMGMSPYEAARERNVQENKRKMEALNLRHLSAVIKEAPKTPSPLKPKRRRIIE
NAVVVPSPPRRSRRLAQLPEVKYAEIAPHTAERMTRSPRKPADLIYLARSGTVSMKARLE
ATRKAEELESQLDPDIPSFVKAMLHSHVVRGFWLQLPCHFCHTYMPKQDSIITLVDEKGE
EFATNYLAYKKGLSGGWAGFALCHGMHDGDAAVFQLIKPTTFKVYIVRAASDDGSEVDE
Download sequence
Identical sequences C5WUX4
jgi|Sorbi1|5030366|Sb01g044910 XP_002465742.1.57931 4558.Sb01g044910.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]