SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5030729|Sb10g001030 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5030729|Sb10g001030
Domain Number 1 Region: 5-541
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 1.31e-91
Family Acetyl-CoA synthetase-like 0.0000139
Further Details:      
 
Domain Number 2 Region: 763-1065
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 4.12e-36
Family Quinoprotein alcohol dehydrogenase-like 0.008
Further Details:      
 
Domain Number 3 Region: 555-619
Classification Level Classification E-value
Superfamily ACP-like 0.00000081
Family Peptidyl carrier domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5030729|Sb10g001030
Sequence length 1113
Sequence
MAAAEPCCISHAFERAASREPDRLAVIHAAASGGDGEERRFTYGDLLAAVGLLSRRIAAA
LGGTAPDARHDRGQSPGFRAAGAAVPRIVGVYASPSVEYVAAVLAVLRCGAAFLPLDPSW
PEERVSSAVSASNAALVVSSVASRGATLFENSGCPVLRLDSGIRRWFQDENGEDGGEELA
WPCEREWRRKFCYVMFTSGSTGKPKGVCGTEKDDVLLFKTSVSFVDHLQEFLSAVLTCTT
LVIPPPSEWRANPASVANLIKVYRISRMTLVPSLMEIILPTLAEKLSDGCNPLKILIFSG
EVLSVLLWKRVYEVLPEATIINLYGTTEVSGDCTFFDCKDLPAILEQEELNSVPIGFPIS
NCDVSLVTDDGLADEGEISVSGACLFTGYLADSMTSNCPEGSEILAHYRTGDFARRLKTG
ELIFLGRKDRIVKIYGQRFSLEEVESILREHPDVSDAAVTFQSNGSLDFKAYLVLKSIDQ
SPKCIQRYSGLNSSQDVIAPLRNWLIMKLPLAMVPRLFIPMKSLPLTLSGKIDYVKLSSL
DCALEPCESEPESSPVDPHMQVIKKVFSDALLVDEVSEYDDFFALGGNSITAAHVAHKLE
IDMRLLYIYTTPSKLFHALLGERSHVVPPTPEFHNRKRLRKSESLSDSFDPVSAYKDDNF
HGQGQISKEGVYNHFAGNHVNETDGQLNRSMTYDEYRAKNLCPDACSNDEISSGSPWILN
FDLQKKWSVGRCNRFMHGYERMLQLEDICSYVPYNKKGFLMKLWSILLDSCVDASPLLVI
SNGMMTIFIGSHSHLFLCIDGYSGSVRWSVKLEGRIECSATITGDFSEVVVGCYKGKIYF
LDMSTGKLSWTFQTDGEVKMQPVVDKTRNLIWCGSYDHYLYALNYKDRCCTYKISCGGSI
YGSPATDMAQNIIYVASTSGLVTAVSFKEPPFRVLWQYEAGAPIFGSLAIDHQSGKVICC
LVNGLVMALNSQGSIVWKATVGGSIFAGACLSPTLPHQVLIPSRDGNLYSFNTVSGALLW
VYRAGDPITASAFVDELLTSESSGPSERFACICTSSGKVHVIRIRADAKYNQEQAGEGVK
SEELVQGVASIDLPGDIFSSPLMAGDSCCCFFQ
Download sequence
Identical sequences 4558.Sb10g001030.1 jgi|Sorbi1|5030729|Sb10g001030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]