SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5034220|Sb02g031570 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5034220|Sb02g031570
Domain Number 1 Region: 60-295
Classification Level Classification E-value
Superfamily PLP-binding barrel 5.4e-59
Family Alanine racemase-like, N-terminal domain 0.0000019
Further Details:      
 
Domain Number 2 Region: 278-404
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 4.4e-41
Family Eukaryotic ODC-like 0.0000458
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5034220|Sb02g031570
Sequence length 413
Sequence
MVGSSPVQAVLAAPGVRDRKVLAFKSDAHKGNKQDVASGLVHSILASTSPPQRSAFYVLD
LAKVVDLFRAWRRALPDARPCYAVKCNPDPALLGALAALGAGFDCASRAEIEAVLALGVQ
PRDIVYANPCKPEAHLEYAAEVGVNLTTYDSEEEVAKVRRCHPACELLLRLKGPDGGGVR
VDLGTKYGAHADEVVPLLRAAQRAGVGVAGVSFHVGSGASILAVYSGAIQAARAAFDAAA
ALGMPPMRVLDIGGGFVSGPTFDDAAAVINDALAQHFGDLPCVEVIGEPGRYFAETAFTL
AARVIGKRTRGEVREYWIDDGLYGSLNCVIMDHYVPTPRPLASPRPGDKTYTSTVFGPTC
DSFDTVVTGYQLPEMSVGDWLVFDDMGAYTTGAGSNFNGYATSDIKIYVAYSS
Download sequence
Identical sequences C5X6Y9
XP_002462765.1.57931 jgi|Sorbi1|5034220|Sb02g031570 4558.Sb02g031570.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]