SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5034228|Sb02g031650 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5034228|Sb02g031650
Domain Number 1 Region: 60-296
Classification Level Classification E-value
Superfamily PLP-binding barrel 7.69e-58
Family Alanine racemase-like, N-terminal domain 0.00000204
Further Details:      
 
Domain Number 2 Region: 280-415
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 1.3e-35
Family Eukaryotic ODC-like 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5034228|Sb02g031650
Sequence length 426
Sequence
MAEAAAMRAVLEAPGVKGLEVHRLPCDDATNDKDAVTGLIRRIVVTADPPVKSAFSVLNL
GEVVELFAAWRRGLKGVPPYYAVKCNTNPALLGALAALGAGFDCASPAEMDAVLALGVTA
DRIIYANPCKPEAHIEHAARVGVDLTTFDSVEEVDKLRRFHPRCRLLLRLKVPDAGDAAR
WDLGTKYGARQEEVAPLLRAAQSAGLAVSGVAFHVGSAVSRVGVYDAAVEAARAVFDAAA
ARGMPPMRILDIGGGFMAGAASTFQDACDVINSALTRHFGDVPGLQVIGEPGRYFAETPF
TLAARVFGKRARGEVREYWIDDGFYGTLCCVHVENYVPRPVPVSSRAAAGDDEGGESDET
HPSTVFGPTCDSLDVVVKGYHLPELRIGDWLVFHEVGAYTTVLSCNFNGFSASDMKTYVA
YTYYSV
Download sequence
Identical sequences C5X700
XP_002460601.1.57931 4558.Sb02g031650.1 jgi|Sorbi1|5034228|Sb02g031650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]