SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5036141|Sb03g026600 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5036141|Sb03g026600
Domain Number 1 Region: 198-289
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000255
Family B3 DNA binding domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5036141|Sb03g026600
Sequence length 294
Sequence
MTLAADAASWDPIWPFFFFFFFSATAASSALLCSPKPLEEIEVEKMAEAVAYEEQRRRQI
EANKRKLEELQLHHLSATVSEAAAAAVKPSSAKKRKARVPRNATAEPLRRSGRIANLPEN
EKPVYREDSDEERSDQDSDEERSDQDSDEERSDQDSDEERSYQDSDERRVCRCIPGIPCG
YATGYAISKAEELVQKLGSSFHVFTLPMTLFHVTGVFRPGFPTYFCKYLPKRDTMITLVD
EEDDKFCMLYQPSKAALSTGWGGFVVDHKLLDGDCLVFQLIERTMFKVIEIYFA
Download sequence
Identical sequences jgi|Sorbi1|5036141|Sb03g026600 4558.Sb03g026600.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]