SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5036145|Sb03g026620 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5036145|Sb03g026620
Domain Number 1 Region: 146-244
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.3e-21
Family B3 DNA binding domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5036145|Sb03g026620
Sequence length 251
Sequence
MAEAVAYEEQRRRQIEANKRKLEELQLHHLSAAVREAAAAAKPSSAKKRKAQVPRDAAAE
PLRRSGRVANLPEKPIYREVKVNSPFLQVSKSNASVLWDAATSVVAEPLRWSGRLANLPE
KPMYREDSDEERSYAISKADELVQELGSSFPIFTQPITLSHVTGGFWLDLPKYFCQKHLP
KSDETITLVDEEDDESDTLYLVRKTGLSTGWKEFAIERKLLDGDCLVFQLIERTKFKVYI
IRATSYFESEY
Download sequence
Identical sequences C5XPJ7
XP_002455874.1.57931 jgi|Sorbi1|5036145|Sb03g026620 4558.Sb03g026620.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]