SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5045399|Sb08g019887 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5045399|Sb08g019887
Domain Number 1 Region: 133-234
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.94e-23
Family B3 DNA binding domain 0.004
Further Details:      
 
Domain Number 2 Region: 489-591
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.67e-19
Family B3 DNA binding domain 0.0076
Further Details:      
 
Domain Number 3 Region: 5-80
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.42e-16
Family B3 DNA binding domain 0.0047
Further Details:      
 
Domain Number 4 Region: 339-436
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000163
Family B3 DNA binding domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5045399|Sb08g019887
Sequence length 592
Sequence
ILREKYAKNVGDQISETITLKVLDGETYDIEVTKKNNELLLCFGWVAFANAYELEQGDTL
VFRYSGESHFEVQIFSPSTCEKELSCFLTNSIPCVQERITSHDNHLQSPGSERRNKACTV
CKNCISNHYWHHMSDQDRCFIKIMISASDFKNKLTIPKKFATNVGGQIPEEVQLEAPNGK
TYNVKVAKEQNDLVIGTGWTKFSSSHDLRQGDLLVFTYSGYAHFKVRIFDPSNCEKEFSC
VVMDNFPYGQERSISHDNHTQPSTSNMLVKHCSGSSSHKRKTLKTSPTDSPSRKSTEDDD
VKEPLNSVGFQKSWLVFPMGCNMNSEQRAKIDALEQKIRPQIPLYITTMDMTSVSSGILA
ISKDYAVKHLLDKNGTITLSQLNGSKTWAITLDINTVGWYARSTGWLDFICNNGLKEGDI
CIFEPSKGKSRVTLIFHPLEETHHPKSAGYVPSSRSPPHEATEPGYIVPRFTVLNNEQMY
KIKNKVQAIGSPYSVFVRIMKPGDVTPNNCIMRFCSAYDKKYLQRGQDTMSLIYPNKTHT
WEAEIKISNNRYMLGPGWSQFVNDNELKLGDICLFQLMENKKLTMTVHIIRE
Download sequence
Identical sequences 4558.Sb08g019887.1 jgi|Sorbi1|5045399|Sb08g019887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]