SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5048416|Sb01g012450 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5048416|Sb01g012450
Domain Number 1 Region: 279-380
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000000249
Family Ankyrin repeat 0.0013
Further Details:      
 
Domain Number 2 Region: 65-194
Classification Level Classification E-value
Superfamily POZ domain 0.000000298
Family Tetramerization domain of potassium channels 0.097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5048416|Sb01g012450
Sequence length 598
Sequence
MEVSTISFSSPSSSPPSLSPSPPPSQQQQHQPRGATPADLEAVGLRRLSDNLQRLLDPAF
LNCADAEIALAPAKGGGAVGVHRCILAARSAFFLHHFASLPAPAGGGGERPRLELADLVP
GGRHIGQDALVPVLGYLYTGRLKSPPQEATVCMDDACGHGTCRPAIDFVVESMYAASGFQ
ISELISLFQRRLSDFVSEALDEDVVPIIHVASTCDLQDLLNQCIHRVAVSTLDSRYLEKE
LPDDIYCRIKEIRRSTFHDESSESAILDPEHDKRVRNILKALDSDDVDLVGLLLKESTVT
LDDAFAIHYAAAYCEPKVFAELLKLDSANVNRKSNSGYTPLHIACMRREPDIILSLVERG
ASVLERTLDGRDALTICKRLTREKDCNRKLEKYEEKSKAYLCIDILEQELKRKSFILDPI
SIEESIATPLLVDNFHMRLINLENRVAFARIFFPSEAKLVMRIAQADSTEEFAGITNFSK
LKEVDLNETPTMQNRRLRERLDALTKTVELGRRYFPHCSDVLDKFLNEESTDLIFLETGT
PEDQRVKRMRFSELKEDVRKAFTKDKAAVAAIASSASSSSSPRCEGRGRSNRKLRPSR
Download sequence
Identical sequences C5WQB3
XP_002464110.1.57931 4558.Sb01g012450.1 jgi|Sorbi1|5048416|Sb01g012450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]