SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5048522|Sb01g014400 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5048522|Sb01g014400
Domain Number 1 Region: 229-329
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.27e-22
Family B3 DNA binding domain 0.0033
Further Details:      
 
Domain Number 2 Region: 412-516
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.93e-20
Family B3 DNA binding domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5048522|Sb01g014400
Sequence length 517
Sequence
MGECPLKVLFPNIFSIALHPDIDVYQAFTEGQWRILFRRQLRGIYGVEWEQLQGMLMEVN
LGEGRDKMFWALEQSRKYTSGSLYRAITFGGVRDQRLMNVWKCNIPLKVKIFIWMAAHDR
IQSGVQLKKKQWSGPEECAACDNLETTDHILFQCPLAVYLWSFLRVSLNWSASPTNCTDF
LMEFAEDCRGAKRKVTLFICAGAVKMRKPGKRSRERDAYFYSDHNDEKDKYFFKVLVGDF
RERLAVPEKFEQHFRGLIGNRVKLESRCGHTFDVEVAKNLGKVVLQTGWKEFVTAHDLNM
GDFLVFKCDKTSRFKVFIFDLSCCEKVPPCLVKRNHICGRETREMHIEISSSCGDLPMNV
TTNSSTSLSDSSGDSVRPEDQKSHCVPGYILPRGTCLTCVQMKKLKERVRASSSRIPIYG
CIINNGNVHGRSQALNIPRVYADVYLPFEDQTLMLRCRGKSWEVRCVIKKDKKRVKRLMK
GWKQFARDNKLRLGDLCLFELLENTKYTMNVHVIRAK
Download sequence
Identical sequences 4558.Sb01g014400.1 jgi|Sorbi1|5048522|Sb01g014400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]