SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5052495|Sb03g002980 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5052495|Sb03g002980
Domain Number 1 Region: 262-374
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.44e-16
Family Ankyrin repeat 0.0015
Further Details:      
 
Domain Number 2 Region: 42-190
Classification Level Classification E-value
Superfamily POZ domain 0.00000000165
Family BTB/POZ domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5052495|Sb03g002980
Sequence length 583
Sequence
MEPMESQLTAVALSDSDSASVEGAAAADAADADLQALRRLSDNLAAAFRSPDDYGFLSDA
RIAVPGAPDLRVHRCVLCARSPFLRDVFARRAASDGEEKDKGRDRGKVELRDLLGDEVEV
GYEALRLVVDYLYSGRVAALPKAACLCVDEDGCAHVGCRPAVAFMAQVLFAASTFDVAEL
TNLFQRRLLDVLDKVEVDNLPLILSVANLCNKSCVKLLERCLDVVVRSNLDMITLEKALP
PDVVKAIVDARLSLGLVLPEDKGFPNIHVRRVHRALDSDDVELVRMLLKEGKTNLDDAYA
LHYAVEHCDSKITTELLDFALADVNHRNPRGYTVLHIAAMRREPKIIVSLLTKGARPSDL
TFDHRKAVQISKRLTNHGDYFGPTEDGKPSPKDRLCIEILEQAERRDPHLGEASVSLAIE
GDSARGRLLYLENRVALARILFPMEARVAMDIAQVDGTLEFTLGSNANLPTEIQRTVDLN
DTPFIMKEEHLARMRALAKTVELGKRFFPRCSKVLDKIMDDETELASLGRDTSTEKKRRF
HDLQDLVHKAFSEDKEENDRSAARSSSSSSTTSIGIGAVRPRR
Download sequence
Identical sequences C5XLW7
XP_002455011.1.57931 4558.Sb03g002980.1 jgi|Sorbi1|5052495|Sb03g002980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]