SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5053724|Sb03g034850 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5053724|Sb03g034850
Domain Number 1 Region: 221-295
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.42e-29
Family B3 DNA binding domain 0.058
Further Details:      
 
Domain Number 2 Region: 160-205
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000772
Family Type II restriction endonuclease effector domain 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5053724|Sb03g034850
Sequence length 1467
Sequence
MGIDLNMVGGEGHDRRPPPPVSRELWHACAGPVVALPRRGSLVVYLPQGHLAAAGGGDVA
ADLPPHVVCRVADVELCGHLAAAGGGDVAADLPPHVVCRVADVELCADAATDEVYARLAL
VAEGEADAATDEVYARLALVAEGEAFGRNLHGGGAEGDDDMEDLDAERKSRMLHMFCKTL
TASDTSTHGGFSVPRRAAEDCFPPLAFGRNLHGGGAEGDDDMEDLDAERKSRMLHMFCKT
LTASDTSTHGGFSVPRRAAEDCFPPLDYNQLRPSQELVAKDLHGTKWKFRHIYRGLXSAQ
AFSRAGCQGFAWNXMEVSSYIXGSASXASLDYWMEFICQXKETGFRGCCVISPVSLVGIS
XLLDGVHLSIKRNWFQGMLCYFSEVMMVNXGLVYGEPFSLKMRPFLKISVVTVQSGIHCR
LXLIPXSTEVFFTFLTIQEVMMVNXGLVYGEPFSLKMRPFLKISVVTVQSGIHCRLXLIP
XSTEVFFTFLTIQELLLQNILFHTISSXRASIIQSVLEQGSTFSAIMKMLVKELLLQNIL
FHTISSXRASIIQSVLEQGSTFSAIMKMLVKGDLEWLFALVKXIPXNGLARSGEACWRSG
MVVRISEIDPMKWPGSKWRSLLVRWEDGAECNGQDRVSPWEIEVAGGSVSVAHSLSASSS
KRTKLCAQGNLDVPTMCKMGGWCXMXRPRXSISMGDRGSWWFCLCCSFSVRIXFXKNQVV
CSGKFGRSNNVCYREWLYXLRGNWKVTQGLARSRIDGFXDSSCSVCSSNCXGCKTSIFXC
XXVSXXCTXLRIECSNKQTRSAXLWFYLPICRLQXIYWILRGLARSRNFSGSSYVPRNDV
XGLFTERRIWATXLYAYPSCCXWIISPSSRMLSDTIYSARSTSALSLPXXYFXPNCGSAA
WTGKQVWWWRYKWPAVWPIXXAEGNLDQATAXNTXSNELGSVXDXKSFSTWRCWXAWVWW
RGGSQNXLQTFWFLLDXEDLASRXXWRQGSELXAXVPEPTDAGSVWVQLLNPECCSSGSV
CCPHWNVMLLQXGCRVFPCILRSFTFPVPQCTSXAAFXHHSLYWSASSXAVICTNKRRIV
GEPLLAWPHPAMQAIVVSLRISRDTALXLMWLILQNCSAICFKSTWLADFRFMGRFVSFN
VPSMYLXISSXLFLALTITSPGCSRLGRVIVSDVRQMLCFKLCCLWIFILVDCVXILCSS
LHAEWLYXLRGNWKVTQGLARSRIDGFXDSSCSVCSSNCXGCKTSIFXCXXVSXXCTXLR
IECSNKQTRSAXLWFYLPICRLQXIYWILRGLARSRNFSGSSYVPRNDVXGLFTERRIWA
TXLYAYPSCCXWIISPSSRMLSDTIYSARSTSALSLPXXYFXPNCGSAAWTGKQVWWWRY
KWPAVWPIXXAEGNLDQATAXNTXSNELGSVXDXKSFSTWRCWXAWVWWRGGSQNXLQTF
WFLLDXEDLASRXXWRQGSELXAXVPE
Download sequence
Identical sequences jgi|Sorbi1|5053724|Sb03g034850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]