SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5053778|Sb03g035720 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5053778|Sb03g035720
Domain Number 1 Region: 307-410
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.02e-18
Family Ankyrin repeat 0.0015
Further Details:      
 
Domain Number 2 Region: 65-112,142-223
Classification Level Classification E-value
Superfamily POZ domain 0.000000000000306
Family BTB/POZ domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5053778|Sb03g035720
Sequence length 621
Sequence
MEPSSSITFASSSSYLSNGSSPCSVAMPPPGPPQAPPLAGGEGWGGGVATAGSGSSVEAV
SLNRLSKNLERLLLDRDLDCSDADVEVPDGGPPVPIHRCILAARSDFFYDLFAARGRGGA
LRGDATAGAGGAAEGAASGRPRYKMEELVPGGRVGREAFQAFLGYMYTGKLRPSPVDVVS
CADPVCPHDSCPPAIRSAVELMYAACTFKIPELTSLFQRRLLNFVDKTLVEDVIPILKVA
SHSGLTQVIDKCIQRIARSDLDDISLDKELPPEAVEEIKNLRKKSQTADGDGDAFISDPV
HEKRVRRIHRALDSDDVELVKLLLNESDITLDDANALHYAASYCDNKVVSELLDLALANL
NLKNSRGYTALHLAAMRREPAIIMCLLNKGANVSQLTADGRSAIGICRRLTRLKDYNTKM
EQGQESNKDRLCIDILEREMMRNPMAVEDAVTSPLLADDLHMKLLYLENRVAFARLFFPA
EAKVAMQIAQADTTEEFGGIVAASTSGKLREVDLNETPVTQNKRLRSRVDALMKTVELGR
RYFPNCSQVLDKFLEDDLPDGLDQFYLQRGTADEQKVKRMRFCELKEDVLKAFSKDKADS
SMLSGLSSSSSCSPPQKSAKR
Download sequence
Identical sequences C5XKY6
jgi|Sorbi1|5053778|Sb03g035720 XP_002456404.1.57931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]