SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5055387|Sb04g025030 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5055387|Sb04g025030
Domain Number 1 Region: 676-749
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000235
Family B3 DNA binding domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5055387|Sb04g025030
Sequence length 762
Sequence
MIGSAPDSARRKPSHDRANDEVRHGDTVVKNTKRSADAFTEKRKKKDHLYNANHGKDRDI
RNGDQRIKKSRVPAASSEKGREKGDHDLNKTSSKKKMMGVDLDKKRTVTSRRKKLERERK
KKLLINASIRKNMQRDDGEEGRIMSNYYETKVKSKKVSTTLSDKERNKEKLNKTHREKKM
QAADSKMRNHDSGVNKGKVSTTFCDKEKKRKRPSNTNSEKETAPITYAVKEKKMRTTENS
EGKCSKVLVSKVAETLVFHQGWDIFVSNHLIKWDSCERVDFNPESTNKGGRKKQAWSNMP
PDDLVITDGSSQNIDDGYYVSGECPRTKVPQTCHVTCNTKNDPKQVEHVVGSGVMAQDNN
GKSIDPQCKTKGTSPLCSKGKTLITLIDSEDSEPLEHENGDTMKLATSVADSDTSLVAVN
TNEGPIRAQSGIGNGPSVVLGDEKGSSPEIECGTKSISTTCSEGKTRSQIIITSTALLDL
HDSDEDLGRKQRTNVVPLDSITPVIDYHNHSKTDIIQNLYRKYEAPGGFRCLEKWRKDVV
NNQASLDCTVPIKPENPQKNDSMLVDGYGSIELNPVDEYICSEGNHECVQPLFTMPIKEP
SSADRVTNCGHDGTEIDYSINEKDGEHCFSKQEGRMPSNTEVPEPLLPMKDKILELDYHS
PPEINSQLCIPDTTQKWLGLSKSLSSAVIRQRRHHWDVVMLKDPMKRLWPIIYHDNPIFV
GFTAGWKHFVAANNLQTGDVCELIKESEDDEPVYSVRMCGKI
Download sequence
Identical sequences 4558.Sb04g025030.1 jgi|Sorbi1|5055387|Sb04g025030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]