SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5058137|Sb06g032870 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5058137|Sb06g032870
Domain Number 1 Region: 298-395
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.26e-17
Family B3 DNA binding domain 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5058137|Sb06g032870
Sequence length 434
Sequence
MANAKGSSAGAAGAGHADLGRAISHEQHQAFMMASVHRAAPGAANVHQQHFHQYPAGLIR
APVPMPVHVPVSQTPYSAQIAVPPPQPLIPPPDHRLHSLPPTGCYQDYSPYGNTASLQHT
AARGFADWGVHNNAIVSLAHATSFANGSNNINSNGLLHQNLSPYTTHTWTTTYVQRPYNT
AYAPATMNMLQTPSFHSNNHEKESGAVFSNSFNMGPSGTPTSPFQLTSPSSTNYTSTQIF
EETNNLEDTSRVFGGGDNESNNSEEPDPTPAVEMEDLNQGNGHISFTNKKVNCQDYRMVL
RKDLTNSDVGNIGRIVLPKKDAEPNLPILEDKDGLILEMDDFELPAVWKFKYRYWPNNKS
RMYILETTGEFVKRHGLQAKDILIIYRNKRSGRYVARAVKAEHIPAPGCECIKAGNPREE
CGFSVSPSVKKIIT
Download sequence
Identical sequences C5YAI1
XP_002448770.1.57931 4558.Sb06g032870.1 jgi|Sorbi1|5058137|Sb06g032870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]