SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5059338|Sb08g003330 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5059338|Sb08g003330
Domain Number 1 Region: 95-351
Classification Level Classification E-value
Superfamily PLP-binding barrel 1.24e-69
Family Alanine racemase-like, N-terminal domain 0.00000752
Further Details:      
 
Domain Number 2 Region: 325-482
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 1.23e-45
Family Eukaryotic ODC-like 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5059338|Sb08g003330
Sequence length 489
Sequence
MAAANLLSRSLLPTPNPTQTSHPNRRSPAVVSFPRRHGRLSVRASVSTASPSPPPQPAAA
AAAGVPKHCFRRGADGYLYCEGVRVEDAMAAAERSPFYLYSKPQILRNFAAYRDALQGLR
SIVGYAVKANNNLPVLRVLRELGCGAVLVSGNELRLALQAGFDPARCIFNGNGKTFEDLK
LAAESGVFVNVDSEFDLENIVRAARATGKKVPVLLRINPDVDPQVHPYVATGNKTSKFGI
RNEKLQWFLDSIKSYPDEIKLVGVHCHLGSTITKVDIFRDAAVLMVNYVDEIRAQGFKLE
YLNIGGGLGIDYHHTDAVLPTPMDLINTVRELVLSQDLTLIIEPGRSLIANTCCFVNRVT
GVKSNGTKNFIVVDGSMAELIRPSLYGAYQHIELVSPPTPGAEVATFDIVGPVCESADFL
GKDRELPKPDEGAGLVVHDAGAYCMSMASTYNLKLRPPEYWVEEDGSIVKIRHEEKFDDY
MKFFDGLPA
Download sequence
Identical sequences C5YS29
XP_002442818.1.57931 jgi|Sorbi1|5059338|Sb08g003330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]