SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5059833|Sb08g021810 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5059833|Sb08g021810
Domain Number 1 Region: 271-590
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 6.28e-90
Family IF2B-like 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5059833|Sb08g021810
Sequence length 597
Sequence
MDIRRAPPSRAASGGVEPRFRQVGFVTAAEPARGPVAPAAASPTASDGLSPVMIPPPLIP
APAPASESLMPSSPPPASSYLLEVVSDLDDYADDDDIDVSWARPPPPALPEANKRDLTET
KNEHAPTPVSQKPKLSKAERRAIQESQRAAKAAAKEAGLKPTAMASDASTKISKQPKTAK
TSLKKDVNQVNPPVATDKKTGERPPDKDRKKDVPQPRMQFDDAHRVVKAKKRSVVNQSEA
RNRVELFRHLPQYAHGTQLPDLESKFLQPDLMHPSVYKVGLQYLSGDISGGNARCIAMLL
AFREAINDYSTPAEKILNRDLTAKISSYVSFLIDCRPLSISMGNAIRFLKNRITKLPLAL
SESEAKVSLQSDIDRFINEKIIVADKVIVSHAVTKIRDDDVLLTFGSASVVEMIFDHAHE
LGKKFRVVVVDSRPNHEGQILLRQLVAKGISCTYTHINAVSYIMHEVTRVFLGASSVLSN
GTVYSRVGTALVAMVAHAFGVPVLVCCEAYKFHERVQLDSICFNELGDPDAISRVPRDAS
LSHLKNWAENENLHLLNLKYDITPSDYVSMLITDYGMLPPTSVPVIVREYRREHVWI
Download sequence
Identical sequences C5YSD0
XP_002443574.1.57931 XP_021302104.1.57931 XP_021302105.1.57931 XP_021302106.1.57931 4558.Sb08g021810.1 jgi|Sorbi1|5059833|Sb08g021810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]