SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5061216|Sb10g002070 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5061216|Sb10g002070
Domain Number 1 Region: 114-397
Classification Level Classification E-value
Superfamily PLP-binding barrel 2.8e-65
Family Alanine racemase-like, N-terminal domain 0.0028
Further Details:      
 
Domain Number 2 Region: 492-596
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 0.0000575
Family Eukaryotic ODC-like 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5061216|Sb10g002070
Sequence length 701
Sequence
MPALAVDATTPVAHAIASCDAAARFPAPPVVGPAAAAAADPVPWSADLSAALYNVDGWGA
PYFFVNDDGDVAVRPHGPATLPGQEIDLAKVVAKAAGPREGGGLGLPLPLLVRFPDVLRH
RVETLNAAFGYAVRSTGYGSRYQGVYPVKCNQDRYVVEDIVEFGAPFGFGLEAGSKPELL
LAMSCLAARGNPDALLICNGYKDDGYVSLALMARSMGLNTVIVLEQEEELDIVVEASRRL
GVRPVVGMRAKLRTKHAGHFGSTSGEKGKFGLNAAQILSVVTKLKAIAMLDCLQLLHFHI
GSQIPTTALLSDGVGEAAQIYCELARLGADMRVIDVGGGLGIDYDGTHSAQTDMSVAYSL
EEYATAVVAAVGRVCDRKVVQHPIICSESGRALVSHHSVLVFEAFSATAPGRLDAATAYL
LDELTDDCRGDYRNVMAAAVRGDYDTCALYADQLKRRSAEQFKEGVLGLEHLAAVDAFCE
LVARGMGAPEPPRTYHINLSVFTSLPDMWAIGQQFPIIPIQRLQERPAVDGVLSDLTCDS
DGKVSEFIGGRHSLPLHELPTHATRGYYLGMFLGGAYQEALGGLHNLFGGPSVVRVSQCD
GPHCFAVTRAAAGPSCADVLRAMQHEPEVMYEVLKQRTDGATAAALARAFGAMPYLVFDP
EAAVLSSGESSGMSSDSEGSAAGAAEEEDDEEWEFMRGLTV
Download sequence
Identical sequences C5Z3B3
XP_002437758.1.57931 jgi|Sorbi1|5061216|Sb10g002070 4558.Sb10g002070.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]