SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5062361|Sb01g014480 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5062361|Sb01g014480
Domain Number 1 Region: 406-510
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.31e-17
Family B3 DNA binding domain 0.004
Further Details:      
 
Domain Number 2 Region: 211-311
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.24e-16
Family B3 DNA binding domain 0.0093
Further Details:      
 
Domain Number 3 Region: 3-53
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000184
Family PHD domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5062361|Sb01g014480
Sequence length 513
Sequence
MNIVCEVCGDIGFRQLLLCCRDCKRYAVHQYCLDKVVFDASLIEWFCYECQQRRGEVTCI
RSLEQVSSEGPLSHGQFGTLVHQLTTKRVESVRDAGPYSPNGGCDELFSCPGIENIPRVR
ERSVDPINISRISEHDTTQASASSERSTECQTASSCRREKTAKMAMASSSSEESGEDILS
EKEFLEYVLAYRCYLSKAQKKRVMELIQEIQPEFTIFISIMRRGNVQPPGPFLGITRDYA
SAHFPDGSKHVTLETPGKSKKWHPKFYRRDESRNYMLIGQWLDFVRDNHVQEGDICLLVP
TKDEIRCTFMVYVLHEATHSRGGAGFQMGGPFPGASSAHMASEIHIEEEPIAGEHVSSES
DMQEIPHEPLEGGDSDDQFVPPYIVPCKSPLSKSQKRIVEERVRAIRSEIPICVAVMKNN
NVGVAQRWMLELGSRYGSVYLPTKGQNIWLQCGGKTWKAKMMFHNGRRWFLNGGWPNFAR
GNGLRVGDICLFELKKKESKLTMAVHIIRKEKF
Download sequence
Identical sequences C5WS98
XP_002466812.1.57931 jgi|Sorbi1|5062361|Sb01g014480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]