SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000000067 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000000067
Domain Number 1 Region: 236-299
Classification Level Classification E-value
Superfamily RILP dimerisation region 2.88e-18
Family RILP dimerisation region 0.0000376
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000000067   Gene: ENSOCUG00000000077   Transcript: ENSOCUT00000000077
Sequence length 387
Comment pep:known_by_projection chromosome:OryCun2.0:19:16493608:16496750:1 gene:ENSOCUG00000000077 transcript:ENSOCUT00000000077 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPRRVAPGAQGWGPRAAAGSGTAAELVYHLAGALGTELQELARRFGPEAAAGLVPLVVR
ALELLEKAAVGPAPDSLQVSAQQAELELRRLREENALLRRELRSGPQEERALLQQLQEVT
DRQRDELRAHHRDLRQRSQETEALQEQLQRLLLVNAELRHKLAAVQTQLRAAQDRERERE
VPHRDAPELAKEREQGQAGEPGCEQRREPERTSPNSPAAAPRQPERPPEAGQCGFSRQEL
EQILQERNELKAKVFLLKEELAYFQRELLADHRVPGLLLEAMKVAVRKQRKKIKAKMLGT
PEEAESSEDEDGSWLLLSGDKEEQPAPPESRVQSFFGLWYRDKAETPTPEPSSTGEEGAP
QQPHVEPPGGPQPPPPDQPCSALRQPL
Download sequence
Identical sequences G1SCJ2
ENSOCUP00000000067 9986.ENSOCUP00000000067 ENSOCUP00000000067 XP_002719092.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]