SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000000173 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000000173
Domain Number 1 Region: 69-263,532-691
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.37e-49
Family Quinoprotein alcohol dehydrogenase-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000000173   Gene: ENSOCUG00000000193   Transcript: ENSOCUT00000000195
Sequence length 985
Comment pep:novel scaffold:OryCun2.0:GL018787:580180:638796:-1 gene:ENSOCUG00000000193 transcript:ENSOCUT00000000195 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRFKVSKFRNVEVRLSRREAWISNIQAGTAPSSGNRIKSSCSLIAFNSDRPGVLGIVPL
EGQGGDKRQVAHLGCHSDLVTDLDFSPFDDFLLATGSADKTVKLWRLPAPGQAPPSGPGV
VLGPEEHPVEALQFHPTADGVLVSAAGTAVKVWDAAARQPLTELVAHGDLVQSAVWSRDG
ALVGTACKDKQLRIFDPRAKHQASQSTQAHENSRDGQLAWTATQEHLVSTGFNQMREREV
KLWDTRLFSSALASLTLDTSPRSLMPLLDPDSGLLVLAGKGESQLYCYETAPRQPALSPV
NQCILENVLQGAALVPRRALAVMSCEVLRVLQLSDTAIVPVGYHVPRKTVEFHEDLFPDT
AGCVPASDSHAWWTGSNQQVQKVSLDPARRPHPSFTSCLVPALEPHLGTAQPAETPVDDA
DPSEGFSSPPSSLTSPSTLSSTTSGIGTSLSQRSLQSLLGPSSKFRHAQGTVLHRDSHIT
NLKGLNLTTPGESDGFCANQLRVAVPLLSSGGQVAVLELRKPGRLPDTALPTLQNGAAVT
DLAWDPFDPHRLAVAAEDARIRLWRVPPEGLEEVLTTPEAVLTGHTEKIYSLRFHPRAAD
VLASSSYDLTVRIWDLQAGAERLRLRGHQDQIFGMAWSPDGQQLATVCKDGRVRVYEPRN
GPEPLQEGPGPEGGRGARVVWVCDGRCLLVSGFDSRSERQLLLYAAGALAGGPSAVLGLD
VAPSTLLPSYDPDTGLVLLTGKGDTRVFLYELLPEAPFFLECNSFTSPDPHKGFVLLPKT
ECDVREVEFARCLRLRQTSLEPVAFRLPRVRKEFFQDDVFPATAVTWEPVLSAQAWLGGA
DGQPRMLSLQPPGMTPVSQAPREAPARRGPSSAQYLEEKSDQQKKEELLSAMVAKLGNRG
GPLPQDSFERRGRGRVGQVPGPDHCDGRPGGGQGLCTGPAAGICSQPGSSRRPGPRRPPV
CSCFQPLGPESPGGAADPQRLQAEP
Download sequence
Identical sequences G1SCT5
ENSOCUP00000000173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]