SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000000190 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000000190
Domain Number 1 Region: 409-507
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 8.98e-18
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.016
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000000190
Domain Number - Region: 262-316
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0987
Family BphP N-terminal domain-like 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000000190   Gene: ENSOCUG00000000215   Transcript: ENSOCUT00000000216
Sequence length 1281
Comment pep:known_by_projection scaffold:OryCun2.0:GL018969:277359:311093:-1 gene:ENSOCUG00000000215 transcript:ENSOCUT00000000216 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQMRRSRDQWRAGGRARRARSRFPLCDSGGSGRRRRRRGLRAGLGGGGGGRGPGERADWP
AEGPATAGRLAPEPNMNGYVEFAPSAGHPRVEPLDPRPGKAPVQEDVDMSSGSSGNEANE
NSSMGRESQGSDCDDSGKELGMLVEPPDARQGPAAFGLTMAEPASDCLSLESHSSQQAAK
ADVHRELIRTLKELKVHLPADRKAKGKASTLATLKYALRSVKQVKANEEYYQLLMSSESQ
PRGVDVPSYSVEEVESVTSEYVVKNGDMFAVAVSLVTGRILYISEQVASIFHCKRDAFSD
AKFVEFLAPHDVSVFHGCTTPCKLPAWSACSRGDFTQECTEEKSFFCRVSVGKNHENEIR
YHPFRMTPYLAKVRERPGAESQLSCLLLAERVHSGYEAPRIPPEKRIFTTTHTPNCLFQD
VDERAVPLLGYLPQDLIESPVLLQLHPSDRPLMLTIHKKILQAGGQPFDYSPIRFRARNG
EYITLDTSWSSFINPWSRRVSFIIGRHKVRVGPLNEDVFTAHPCAEEKAPHPGVQELTEQ
IHRLLLQPVPHSGSSGYGSLGSNGSQEHLLSHTSSSDSNGHEDSRQRRPEICKTDKAKAR
GHHSHGPGEQKKTCVPDLQSGHAAQERAVPAAEDSSADSASRAGFPEELACRPQPACSYQ
QISCLDGVIRYLESCSEAATLKRKCEFPANIATRKTTVSPGLHATEAASPPEVNSHAEVS
AHLSSLALPSKAESVVSLTSQCSYSSTIVHVGDKKPQPELETVEDAASGPESLDWLAGPL
SQEREPFKPLGLPKEWLPAHTQKKGRSFLTRPRDGGRLGFPHSPCHHSRQEPPKGRSGER
ASPGLRNASGIDSSWKKAGKNRKLKCKRAKPRDSSESTGSGGPAPPRPPLVGLNATAWSP
SATSQSSCPAVPAYSLPVFPAPMAPHASLTVPTVPLDAQYQLAVQAPLAPVMALVLPSHP
LSLPQAFFPSHAVLQSPAAPASQPEFARPPCACPATPATPPLASGAGGRASPPLFQSRGS
SPLQLNLLQLEEAPEGGVGATGTPGTAATGPDCKPATSRDRQLKAPPAQEEPSDTPNSDA
LSTSSDLLDLLLNDALGSAAGSALSGSSASDSLGCDASRSGAGSSDTSRSSRYFGSIDSS
ENNHRAARPPRLGAGEQLLRCVLQDPLWLLMADTDDSVMMTYQLPARDADTVLKEDREQL
RLLQKSQPWLTEGQRQELHEVHPWVQTGGLPAALDVAECVYCANKDRGSLCPPCEEDAGP
GGLGEEEEEGPAPSQAREGQT
Download sequence
Identical sequences G1SCU7
ENSOCUP00000000190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]