SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000000205 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000000205
Domain Number 1 Region: 18-117
Classification Level Classification E-value
Superfamily 4'-phosphopantetheinyl transferase 8.89e-25
Family 4'-Phosphopantetheinyl transferase SFP 0.0062
Further Details:      
 
Domain Number 2 Region: 125-253
Classification Level Classification E-value
Superfamily 4'-phosphopantetheinyl transferase 2.62e-23
Family 4'-Phosphopantetheinyl transferase SFP 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000000205   Gene: ENSOCUG00000000231   Transcript: ENSOCUT00000000232
Sequence length 309
Comment pep:known_by_projection chromosome:OryCun2.0:1:110575229:110597042:-1 gene:ENSOCUG00000000231 transcript:ENSOCUT00000000232 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVFPAKRLCLVPSMEGVRWAFSCGTWLPSRAEWLLAVRSIQPEEKERIGQFVFARDAKAA
MAGRLMIRKLVAEKLNIPWNNIRLQRTAKGKPVLAKDSLNPYPNFNFNISHQGDFAVLAA
EPELQVGVDIMKTSFPGRGSIPEFFHIMKRKFTNKEWETIRSFKDEWTQLDMFYRNWALK
ESYIKAIGVGLGFELQRLEFEISPLNLDIGQVYKETRLFLDGEEEKEWAFEESKIDEHHF
VAVALRKPDGSRHQDVPSLDDSKPSQRQFTILTFNDLISSAVPMTPEDPSFWDCFCFTEE
IPIRNGTKS
Download sequence
Identical sequences G1SCV9
ENSOCUP00000000205 9986.ENSOCUP00000000205 XP_002708559.1.1745 ENSOCUP00000000205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]