SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000000533 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000000533
Domain Number 1 Region: 53-178
Classification Level Classification E-value
Superfamily FKBP-like 1.73e-39
Family FKBP immunophilin/proline isomerase 0.0003
Further Details:      
 
Domain Number 2 Region: 158-275
Classification Level Classification E-value
Superfamily FKBP-like 5.89e-38
Family FKBP immunophilin/proline isomerase 0.00028
Further Details:      
 
Domain Number 3 Region: 294-388
Classification Level Classification E-value
Superfamily FKBP-like 2.36e-31
Family FKBP immunophilin/proline isomerase 0.00054
Further Details:      
 
Domain Number 4 Region: 1-54
Classification Level Classification E-value
Superfamily FKBP-like 2.75e-17
Family FKBP immunophilin/proline isomerase 0.0014
Further Details:      
 
Domain Number 5 Region: 393-469
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000156
Family Calmodulin-like 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000000533   Gene: ENSOCUG00000000611   Transcript: ENSOCUT00000000612
Sequence length 483
Comment pep:known_by_projection chromosome:OryCun2.0:19:42713269:42719450:1 gene:ENSOCUG00000000611 transcript:ENSOCUT00000000612 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRGLMGMCVNERRRLIVPPHLGYGSIGVAGLIPPDATLYFDVVLLDVWNKADTVQVNIL
LRPPHCPRMVQDSDFVRYHYNGTLLDGTTFDTSYSRGGTYDTYVGSGWLIKGMDQGLLGM
CPGEKRKIIIPPFLAYGEKGYGTVIPPQASLVFHVLLVDVHNPKDSVQLETLELPPGCVR
RAAAGDFMRYHYNGSLMDGTLFDSSYSRNHTYNTYIGQGYIIPGMDQGLQGACVGERRRV
TVPPHLAYGENGTGDKIPGSAVLIFDVHVIDFHNPADPVEIKTLSRPAEACNETEAAKLG
DFVRYHYNCSLLDGTQLFSSHDHGAPQEATLGANKVIEGLDRGLQGMCVGERRQLIVPPH
LAHGESGARGVPGSAVLRFEVELVSREDGLPTGYLFVWHKDPPASLFEDMDLNKDGEVPL
EEFSTFIKAQVSEGKGRLLPGQDPEKTIRDMFQNQDHNQDSKVTAEELKLKSDEDQERVH
EEL
Download sequence
Identical sequences G1SDP2
ENSOCUP00000000533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]