SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000000700 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000000700
Domain Number 1 Region: 17-134
Classification Level Classification E-value
Superfamily FKBP-like 3.73e-32
Family FKBP immunophilin/proline isomerase 0.00019
Further Details:      
 
Domain Number 2 Region: 112-205
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000419
Family Calbindin D9K 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000000700   Gene: ENSOCUG00000000805   Transcript: ENSOCUT00000000805
Sequence length 211
Comment pep:known_by_projection chromosome:OryCun2.0:10:14433678:14445151:-1 gene:ENSOCUG00000000805 transcript:ENSOCUT00000000805 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFVLWNAVLTLLATALSGALIPEPEVKIEVLQKPFICHRKTKGGDLMLLHYEGYLEKDG
SLFHSTHKHNNGQPIWFTLGILEALKGWDLGLKGMCVGEKRKLIIPPALGYGKEGKGKIP
PESTLIFNIDLLEIRNGPRSHESFQEMDLNDDWKLSKNEVKVYLKKEFEKHGAVVNESHH
DVLVEDIFDKEDEDRDGFISAREFTYEHDEL
Download sequence
Identical sequences G1SE41
XP_002713780.1.1745 9986.ENSOCUP00000000700 ENSOCUP00000000700 ENSOCUP00000000700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]