SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000000756 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000000756
Domain Number 1 Region: 330-500,535-701
Classification Level Classification E-value
Superfamily (Trans)glycosidases 7.02e-79
Family YicI catalytic domain-like 0.00099
Further Details:      
 
Domain Number 2 Region: 1194-1390,1434-1595
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.84e-73
Family YicI catalytic domain-like 0.00037
Further Details:      
 
Domain Number 3 Region: 99-329
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 3.77e-47
Family YicI N-terminal domain-like 0.0096
Further Details:      
 
Domain Number 4 Region: 946-1191
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.1e-46
Family YicI N-terminal domain-like 0.0063
Further Details:      
 
Domain Number 5 Region: 1598-1678
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 6.69e-19
Family Putative glucosidase YicI, domain 3 0.0089
Further Details:      
 
Domain Number 6 Region: 704-784
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 3.09e-16
Family Putative glucosidase YicI, domain 3 0.01
Further Details:      
 
Domain Number 7 Region: 56-110
Classification Level Classification E-value
Superfamily Trefoil 0.000000000419
Family Trefoil 0.005
Further Details:      
 
Domain Number 8 Region: 918-969
Classification Level Classification E-value
Superfamily Trefoil 0.00000000105
Family Trefoil 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000000756   Gene: ENSOCUG00000000872   Transcript: ENSOCUT00000000872
Sequence length 1741
Comment pep:novel scaffold:OryCun2.0:GL018758:1008461:1083833:1 gene:ENSOCUG00000000872 transcript:ENSOCUT00000000872 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARKLSLLEALLIAFDVIVVIADVLLLILLLENPSVDKIQNKCYTLYANLFYADSSFTPE
CPEISQSERIDCAPGRVVTEEVCRQQLKCCWSPVADAAVPVCFFPRNWGYEVSDGIRDTS
TGFTAQLTRVPSPSLFGNDVLNALFTAENQTPSRFRFKITDSNNMRYEVPHENIKTLNGT
ADPSSLSYRVEVTDKPFSLKILRTSNQRVLLDTSIGPLQFAHQYLQLSFRLPSANVYGLG
EHVHQQYRHNMTWKTWPIFTRDTTPTAGMINLYGAHTFFLCLEDTSGFSFGVFLMNSNAM
EITLQPAPAVTYRTIGGILDFYVFLGNTPEQVVQEYLELVGRPFLPSYWSLGFQLSRRDY
GGIHGLREVVDRNRRAGIPYDVQYSDIDYMDGKKDFTIDEGAYPGLSDFAKELHDNGQKY
MIIMNPGIFRSPEYTAYNNGSLKRVWILDNHGFAVGEGYPGPAVFPDYSNPEGTQWWTEQ
LTEFHNQLEFDGVWIEMDEVSSLLQGSGHECESNRLNSPPFTPRVLGGRLSERTLCMDTE
FHSGLHYDVHSLYGYSMARATDSAMEAIFLNNRSFILSRSTFAGSGKFAAHWLGDNAATW
DDLRWSIPSILEFNLFGIPMVGANICGYFGNVSEELCRRWMQLGAFYPLSRNHNGPGFMD
QDPAAFGDDSLLLNSSRHYLNIRYTLLPYLYTLFYRAHTLGETVARPLVHEFYQDPATWD
VHEQFLWGPGLLITPVLYEGVDQVKAYIPDDIWYDYETGVAMQWRKQLVDMLLPGDSMGL
HLRGGYIFPTQQPDVNTESSRKNPLGLIIALDYKREAKGELYWDDGESKDAVTERKYILY
DFSVTSNRLQAKILNNNYEDPDSLMFTDIKILGMDKEPTNFSVIFNNAVTSISSVTYSAS
TKVVTITNLQGLVLGQEFSIEWALPVNDLEKFNCYPEDPAVSEENCRLRGCLWEHTTTPG
VPTCFYDTTPNYAASNVQYLSTGITTDLTLLEAPELARAVEPKISNLVLTVTYHTEYMLQ
VKIYDPTNKRYEVPVPLNTPPSPVGSPENRLYDVTIQTNPFGIQIRRKRSSTVIWDSQLP
GFTFNDQFLSISTRLPSQYIYGFGETEHTAFRRNMSWHTWGMFARDEPPAYKKNSYGVHP
YYMGLEEDGSAHGVLLLNSNAMDITLQPTPALTYRTTGGTLDFYIVLGPTPELVTQQYTE
LIGRPAMTPYWALGFQLSRYGYQNVAEIASLYDAMVAAQIPYDVQHVDMDYMDRKLDFTL
SPSFQNLSLLMEQMKEDGMRFILTLDPAISGNETQYLTFTRGQENDVFITWPDTSDIVWG
KVWPELPNVNVNGSLDNEAQWSRAHVAFPDFLRNSTAAWWKKEIQELYTNPQEPEKSLKF
DGLRIDMNEPSNFVDGSVNGCRNDILNNPPYVPYLESRGTGLSSKTLCMESEQILPDGSR
VRHYDVHSLYGWSQTRPTYEAVQEVTGQRGIVITRSTFPSSGRWGGHWLGENTAAWDQLG
KSIIGMMEFSLFGIPYTGADICGFFGDAEYEMCIRWMQLGAFYPFSRNHNTIGTRRQDPV
AWNSTFEMASQKALQIRYSLLPYLYTLMYKAHVEGSTVIRPLLHEFTNDSTTWDIDQQFM
WGPAILISPVLESNTFAIRAYFPQALWYDYSTESGNNSTGEWRILQAPLDHINLHVRGGY
ILPWQEPAVNTHSSRQKFMGLIVALDDNGEAEGELFWDDGQSIGEYAVSSVLVTLRKANP
R
Download sequence
Identical sequences G1SE90
ENSOCUP00000000756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]