SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000001389 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000001389
Domain Number 1 Region: 490-717
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.21e-59
Family Eukaryotic proteases 0.00000000431
Further Details:      
 
Domain Number 2 Region: 205-288
Classification Level Classification E-value
Superfamily Kringle-like 9.42e-34
Family Kringle modules 0.00019
Further Details:      
 
Domain Number 3 Region: 115-208
Classification Level Classification E-value
Superfamily Kringle-like 5.32e-32
Family Kringle modules 0.000013
Further Details:      
 
Domain Number 4 Region: 297-380
Classification Level Classification E-value
Superfamily Kringle-like 9.91e-32
Family Kringle modules 0.00018
Further Details:      
 
Domain Number 5 Region: 375-472
Classification Level Classification E-value
Superfamily Kringle-like 5.8e-29
Family Kringle modules 0.00038
Further Details:      
 
Domain Number 6 Region: 36-125
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 2.43e-22
Family Hairpin loop containing domain 0.00000558
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000001389   Gene: ENSOCUG00000001618   Transcript: ENSOCUT00000001618
Sequence length 725
Comment pep:known chromosome:OryCun2.0:7:34089957:34164200:1 gene:ENSOCUG00000001618 transcript:ENSOCUT00000001618 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWVSKLVPVLLLQQVLLHLLLLPIAIPYAEGQKKRRNTLHEFKKSAKTILIKEDPLLKIK
TKKMNTADQCANRCIRNKGLPFTCKAFVFDKTKKRCLWFPFNSMSSGVKKEFGHEFDLYE
NKDYIRNCIIGKGGSYKGTVSITKSGIKCQPWSSMIPHEHSYRGKDLQENYCRNPRGEEG
GPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGPMDHTESGKICQRWDHQTPHRHKF
LPERYPDKGFDDNYCRNPDGKPRPWCYTLDPDTPWEYCAIKMCAHSIMNDTDVPMETTEC
IQGQGEGYRGTINTIWNGIPCQRWDSQYPHQHDITPENFKCKDLRENYCRNPDGAESPWC
FTTDPNIRVGYCSQIPKCDVSSGQDCYLGNGKNYMGNLSKTRSGLTCSMWDKNMEDLHRH
TFWEPDASKLNKNYCRNPDDDAHGPWCYTGNPLVPWDYCPLARCEGDTTPTIVNLDHPVV
SCAKTKQLRVVNGIPTRTNVGWMVSLKYRNKHICGGSLIKESWVLTARQCFPSRNKDLKD
YEAWLGIHDVHGRGDEKRKQVLNVSQLVYGPEGSDLVLLKLARPAVLDDFVSTIDLPNYG
CIIPEKTACSVYGWGYTGLINSDGLLRVAHLYIMGNEKCSQHHQGKVTLKESEICAGAEK
IGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKIILTY
KVPQP
Download sequence
Identical sequences G1SFS6
ENSOCUP00000001389 XP_008256400.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]