SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000001518 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000001518
Domain Number 1 Region: 575-824
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.24e-69
Family Eukaryotic proteases 0.0000000505
Further Details:      
 
Domain Number 2 Region: 374-467
Classification Level Classification E-value
Superfamily Kringle-like 1.84e-38
Family Kringle modules 0.0000187
Further Details:      
 
Domain Number 3 Region: 280-369
Classification Level Classification E-value
Superfamily Kringle-like 7.25e-37
Family Kringle modules 0.000029
Further Details:      
 
Domain Number 4 Region: 97-191
Classification Level Classification E-value
Superfamily Kringle-like 2.25e-35
Family Kringle modules 0.0000309
Further Details:      
 
Domain Number 5 Region: 191-276
Classification Level Classification E-value
Superfamily Kringle-like 3.14e-35
Family Kringle modules 0.00000672
Further Details:      
 
Domain Number 6 Region: 478-577
Classification Level Classification E-value
Superfamily Kringle-like 1.93e-33
Family Kringle modules 0.00000759
Further Details:      
 
Domain Number 7 Region: 28-92
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 1.92e-16
Family Hairpin loop containing domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000001518   Gene: ENSOCUG00000001766   Transcript: ENSOCUT00000001767
Sequence length 825
Comment pep:novel chromosome:OryCun2.0:12:150109841:150152958:-1 gene:ENSOCUG00000001766 transcript:ENSOCUT00000001767 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RTPRSRPDMEQRAVVLLLLLLLKPGQAEPLDDYVNTQGASLFSFTKKQLGAASIAECAAR
CEAETEFTCRSFQYHSKEQQCVVMAENSKSSAIMSPCDQLSALLPVYLSECKIGNGRSYR
GTKSKTKTGFTCQKWSSSYPHKPNFTPKKYPAEGLEENYCRNPDNDEQGPWCYTTNPDER
FDYCDIPECEDECMHCSGENYEGKISKTMSGIECQAWDSQSPHAHGYIPSKFPNKNLKKN
YCRNPDGEPRPWCFTMDPKKRWELCDIPRCTTPPPPSGPTHQCLKGRGESYRGKVARTKS
GLTCQRWSEQTPHLHNRTPENFPCKDLDENYCRNPDGESAPWCYTTDSKVRWEHCDIPSC
ASSPTSVEPLDAPAPPEETPVVQECYQGNGQSYRGTSSTTITGRKCQSWLSMTPHRHQRT
PQNYPNADLTMNYCRNPDDDIRPWCYTTDPSVRWEYCNLRRCSEPAASPAATVPTAQLPR
PEATFEPDCMFGNGKGYRGKKATTADGTPCQGWAAQEPHRHNIFTPETNPRAGLERNYCR
NPDGDTNGPWCYTMNPRKLYDYCDVPQCASSSSYDCGKPKVEPKKCPGRVVGGCVANPHS
WPWQISLRTRTGQHFCGGTLIAPEWVLTAAHCLEKYPRPSAYRVILGAHKEVNLELDVQD
IDVAKLFLEPSRADIALMKLSSDYIKRKRYTVIPNCLKLPKKCFKKAALVICFTIEHSEA
QDTGTYGAGLLKEAQLPVIENKVCNRFEYLNGRVRSTELCAGHLAGGTDSCQGDSGGPLV
CFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVDWIERTMRNN
Download sequence
Identical sequences G1U9Q9
9986.ENSOCUP00000001518 ENSOCUP00000001518 ENSOCUP00000001518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]