SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000001776 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000001776
Domain Number 1 Region: 5-159
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.5e-42
Family Dual specificity phosphatase-like 0.000000351
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000001776   Gene: ENSOCUG00000002060   Transcript: ENSOCUT00000002058
Sequence length 167
Comment pep:known_by_projection scaffold:OryCun2.0:GL018704:6237788:6248746:1 gene:ENSOCUG00000002060 transcript:ENSOCUT00000002058 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRPAPVEISYENMRFLITHNPTNATLNKFTEELKKYGVTTLVRVCDAPYDKAPVEKEGI
HVLDWPFDDGAPPPNQIVDDWLNLLKNKFREEPGCCVAVHCVAGLGRAPVLVALALIECG
MKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFRDTNGHCCVQ
Download sequence
Identical sequences G1SGQ6
ENSOCUP00000001776 XP_002720682.1.1745 ENSOCUP00000001776 9986.ENSOCUP00000001776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]