SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000002001 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000002001
Domain Number 1 Region: 7-118
Classification Level Classification E-value
Superfamily Kringle-like 5.32e-22
Family Kringle modules 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000002001   Gene: ENSOCUG00000002320   Transcript: ENSOCUT00000002320
Sequence length 268
Comment pep:known_by_projection chromosome:OryCun2.0:21:3726154:3740229:-1 gene:ENSOCUG00000002320 transcript:ENSOCUT00000002320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEGRMQLAWVQTFVLSNMLLAEAYGSGGCFWDNGHLYREDQPSPAPGLHCLNWLDAQGA
LASGPESGAGNHNYCRNPDHDPRGPWCYVSGQTGAPEKRPCEDLRCPETTSLGPPASTVE
MAEAPDAPGEDEAQAFPPAKALPARSEAAAVQPAVGIGQRVRMNSKEKKDLGTLGYVLGI
TMMVIIIAIGTGIILGYTYKRGKDLKAQHEQKACEREMQRITLPLSAFTNPTCEIVDEKT
IVVHASQTPVDLQEGSTPLMGQAGTPGA
Download sequence
Identical sequences G1SHA5
XP_002719748.1.1745 ENSOCUP00000002001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]