SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000002664 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000002664
Domain Number 1 Region: 46-520
Classification Level Classification E-value
Superfamily ALDH-like 2.62e-168
Family ALDH-like 0.000000084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000002664   Gene: ENSOCUG00000003063   Transcript: ENSOCUT00000003062
Sequence length 522
Comment pep:known_by_projection chromosome:OryCun2.0:12:12455571:12488192:-1 gene:ENSOCUG00000003063 transcript:ENSOCUT00000003062 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATCSWLRCRWAPRLRPRAGCRRPVASLVQLRCYARGLAGLSAGLLRTDSFVGGRWLPAA
ATFPVHDPASGAALGSVADCGVPEARAAVRAAYEAFRSWRGVSAKERSALLRNWYDLMIQ
NKDDLAKVITAESGKPLKEAQGEILYSANFLEWFSEEARRIYGDIIATPTKGRRALVLKQ
PIGVAAVITPWNFPSAMITRKVGAALAAGCTVVVKPAEDTPFSALALAELANQAGIPPGV
YNVIPCSRNKAKEVGEVLCTDPLVSKISFTGSTATGKILLRHAASSVKRVSMELGGLAPF
IVFDSANVEQAVAGAMASKFRNAGQTCVCSNRFLVQRGIHDSFVSKFAEAMKTTLRVGHG
FEEGTTQGPLINEKAVEKVEKQVNDAVSKGATIVTGGKRHHLGRNFFEPTLLSSVTQDML
CSREETFGPLAPVIKFDTEEEAIAIANATDVGLAGYFYSQDPAQIWRVAEQLEVGMVGVN
EGLISSVECPFGGVKQSGLGREGSKYGIDEYLEVKYVCHGGL
Download sequence
Identical sequences G1SIY9
ENSOCUP00000002664 XP_002714203.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]