SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000002737 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000002737
Domain Number 1 Region: 27-269
Classification Level Classification E-value
Superfamily CutC-like 3.79e-80
Family CutC-like 0.00000236
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000002737   Gene: ENSOCUG00000003148   Transcript: ENSOCUT00000003149
Sequence length 273
Comment pep:known_by_projection chromosome:OryCun2.0:18:47688421:47724145:1 gene:ENSOCUG00000003148 transcript:ENSOCUT00000003149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRQGLSSERKLARISSGKAGAANGSLMEVCVDSVESAVNAERGGAGRIELCSGLLEGGT
TPSMGLLQIVKQSVQIPVFVMIRPRGGDFLYSDREIEVMKADIQLAKLYGADGLVFGALT
EDGQIDKELCMSLIALCRPLPVTFHRAFDMVHDPMAALETLLTLGFERVLTSGCDSSALE
GLPLIKRLIDEAKGRIVVMPGGGITDRNLQRILEGSGATEFHCSARSARDSGMKFRNSSV
AMGASLSSSEYSVKVTDVTKVRTLNAIAKNILV
Download sequence
Identical sequences G1SJ46
XP_002718684.1.1745 9986.ENSOCUP00000002737 ENSOCUP00000002737 ENSOCUP00000002737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]