SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000002826 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000002826
Domain Number 1 Region: 350-489
Classification Level Classification E-value
Superfamily C-type lectin-like 1.12e-40
Family C-type lectin domain 0.00027
Further Details:      
 
Domain Number 2 Region: 933-1082
Classification Level Classification E-value
Superfamily C-type lectin-like 5.4e-39
Family C-type lectin domain 0.00048
Further Details:      
 
Domain Number 3 Region: 788-925
Classification Level Classification E-value
Superfamily C-type lectin-like 1.17e-37
Family C-type lectin domain 0.00029
Further Details:      
 
Domain Number 4 Region: 638-781
Classification Level Classification E-value
Superfamily C-type lectin-like 2.19e-37
Family C-type lectin domain 0.000000372
Further Details:      
 
Domain Number 5 Region: 1220-1358
Classification Level Classification E-value
Superfamily C-type lectin-like 1.01e-33
Family C-type lectin domain 0.0002
Further Details:      
 
Domain Number 6 Region: 22-153
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.35e-32
Family Cysteine rich domain 0.000000742
Further Details:      
 
Domain Number 7 Region: 499-638
Classification Level Classification E-value
Superfamily C-type lectin-like 1.43e-31
Family C-type lectin domain 0.0012
Further Details:      
 
Domain Number 8 Region: 230-344
Classification Level Classification E-value
Superfamily C-type lectin-like 1.86e-30
Family C-type lectin domain 0.00076
Further Details:      
 
Domain Number 9 Region: 1091-1217
Classification Level Classification E-value
Superfamily C-type lectin-like 4.22e-28
Family C-type lectin domain 0.0013
Further Details:      
 
Domain Number 10 Region: 153-211
Classification Level Classification E-value
Superfamily Kringle-like 5.42e-20
Family Fibronectin type II module 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000002826   Gene: ENSOCUG00000003247   Transcript: ENSOCUT00000003255
Sequence length 1455
Comment pep:known_by_projection chromosome:OryCun2.0:16:43398446:43512584:-1 gene:ENSOCUG00000003247 transcript:ENSOCUT00000003255 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPSLLLAFVSVIPAAVQLLDTRQFLIYNEDHKRCVEAISSSAVQTAVCNPDAESQRFRW
VSEFHVMSVAFKLCLGVPSKTDWVSVTLYNCDSKSEFQKWECKNDTLFGIKGEDLFFNYG
NRQEKNIMLYKGSGLWSRWKIYGTTDDLCSRGYEAMYTLLGNANGATCAFPFKFQNKWYA
DCTSAGRSDGWLWCGTTTDYDADKLFGFCPVKFEGSESLWNKDPLTSISYQINSKSALTW
HQARKSCQQQNAELLSITEIHEQTYLTGLTSSLTSGLWIGLNSLSFNSGWQWSGGSPFRY
LNWLPGSPSAEPGKSCVSLNPGKNAKWENLECVQKLGYICKKGNTSLNSFVIPSESDVPT
NCPSQWWPYAGHCYRIHREEKKIQKDALIACRKEGGDLASIHSIEEFDFIISQLGYEPND
ELWIGLNDIKIQMYFEWSDGTPVTFTKWFRGEPSHENNRQEDCVVMKGKDGYWADRACER
PLNYICKMTSRTQATGIVEVETGCRKGWKRHGFYCYLIGHTLSTFTEANQTCESEKAYLT
TVEDRYEQAFLTSLIGLRPEKYFWTGLSDIQNKGTFQWTIEEEVQFTHWNSDMPGRKAGC
VAMRTGIAGGLWDILKCDEKAKFVCKHWAEGVTRPPEPTTTPEPRCPEDWGTSSKTSLCF
KLFAKGKHEKKTWFESRDFCRAVGGELASINNKEEQQIIWRLITAGGSYHELFWLGLTYG
SPSEGFTWSDGSPVSYENWAYGEPNNYQNVEFCGELKADPGMSWNDINCEHLNNWICQIQ
KGQTLKPEPTPAPQDNPPVTEDGWVIYKDYQYYFSKEKETMDNARAFCKRNFGDLVSIKS
ESEKKFLWKYVNRNDAQTAYFIGLLVSLDKKFAWMDGSKVDYVSWATGEPNFANEDENCV
TMYANSGFWNDINCGYPNAFICQRHNSSINATVMPTVPPGPRGCKEGWNFYNNKCFKIFG
FVEEEKKNWQDARKACIGFGGNLVSIHNEKEQAFLIYHMKDSTFNAWTGLNDVNSEHTFL
WTDGRGVHYTNWGKGFPGGRRSSLSYEDADCVVIIGGKSRDAGKWMDDTCDSKQGYICQT
PSDPSLPSSRTTVPTDGFIRYGKSSYSLMKLKLQWHEADKYCKDDTSLIASILDPYSNAF
VWMQMQTFNVPVWIALNSNLTNNEYVWTDRWRVRYTNWAPDEPKLKSACVYLDLDGYWKT
AYCNESFYFLCKRSDEIPATEPPQLPGRCPESEHTAWIPFHGHCYYIESSYTRNWGQASL
ECLRMGSSLVSIESASESSFLSYRVEPLKSKTNFWIGMFRNVEGMWLWVNNNPVSFVNWN
TGDPSGERNDCVLLDASSGLWNNIHCSSYKGYICKRPKIVDAEPTQTEVTTKADSRKDAP
SKKSSSMAGVVIIVTLLILTGAGFAAYFFYKKRRVHIPQEGTFENTLYFNSRSSPGTSDT
KDLMGNIEQNEHAVI
Download sequence
Identical sequences G1SJC1
XP_002717402.1.1745 ENSOCUP00000002826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]