SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000003345 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000003345
Domain Number 1 Region: 86-222
Classification Level Classification E-value
Superfamily dUTPase-like 5.89e-46
Family dUTPase-like 0.000000159
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000003345   Gene: ENSOCUG00000003862   Transcript: ENSOCUT00000003859
Sequence length 227
Comment pep:known_by_projection chromosome:OryCun2.0:17:24144269:24157931:-1 gene:ENSOCUG00000003862 transcript:ENSOCUT00000003859 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTALVRRPAARYRFLPSLLSAGFTDAWRARLRPERAGLSGPGPPLGPATQRRLLSSATRR
SRGCSGAKAPAISPSKRARAAEEGTMRLRFSRLSEHATAPTRGSARAAGYDLYSAYDYTV
PPMEKAIVKTDIQIALPSGCYGRIAPRSGLAAKYFIDVGAGVIDEDYRGNVGVVLFNFGK
EKFEEVKKGDRIAQLICERIFYPEIEEVQVLDDTERGAGGFGSTGKN
Download sequence
Identical sequences G1SKK1
ENSOCUP00000003345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]