SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000004050 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000004050
Domain Number 1 Region: 96-151
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.00000589
Family VPS37 C-terminal domain-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000004050   Gene: ENSOCUG00000004693   Transcript: ENSOCUT00000004689
Sequence length 359
Comment pep:known_by_projection scaffold:OryCun2.0:GL018717:3950548:3957234:1 gene:ENSOCUG00000004693 transcript:ENSOCUT00000004689 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METLKDKTLQELEEMQNDPEVIARLALESPEVQDLQLEREMALATNRSLAERNLEFQGPL
EISRSNLSDKYQELRKLVERCQEQKAKLETFASALQPGALLDLLQIEGMKIEEESEAMAE
KFLEGEVPLETFLENFSSMRTLSHLRRVRVEKLQDVVRKPRASQEPGGDAPPPRPPPPPR
PAPPATPPAAEEQPPPLSVASAVPPYPLPYSPSPGLPVGPTAQGALQPAPFPVVSQPSFS
YGGPLGPTYPSAQPGPRAAAGYSWSPQRSIPPRPGYPMAPAGASGPGYPAVGGRTPSPGY
PQQSPYLPTAGKPPYPTQPQLPGFPGQPQPSVPPQPPYPPGPAPPYGFPPPPGPAWPGY
Download sequence
Identical sequences G1SMB5
ENSOCUP00000004050 XP_008272649.1.1745 XP_008272650.1.1745 9986.ENSOCUP00000004050 ENSOCUP00000004050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]