SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000004072 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOCUP00000004072
Domain Number - Region: 48-104
Classification Level Classification E-value
Superfamily Molybdopterin synthase subunit MoaE 0.0222
Family Molybdopterin synthase subunit MoaE 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000004072   Gene: ENSOCUG00000004719   Transcript: ENSOCUT00000004713
Sequence length 184
Comment pep:known chromosome:OryCun2.0:13:41040254:41040808:-1 gene:ENSOCUG00000004719 transcript:ENSOCUT00000004713 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESFSSKSLALQAEKKLLSKMVGRSAAHLFIDETSSEVLDELYRVSKEYTHSRPQAQRVI
KDLIKVAVKVAVLHRSGCFGPSELALATRFRQKLRQGAMTALSFGEVDFTFEAAVLAGLL
TECRDVLLELVENHLTPKSHGRIRHVFDHFSDPGLLTALYGPDFTQHLGKICDGLRKLLE
EGKL
Download sequence
Identical sequences B7NZC7
ENSOCUP00000004072 ENSOCUP00000004072 9986.ENSOCUP00000004072 NP_001164767.1.1745 XP_008262236.1.1745 XP_008262237.1.1745 XP_017200998.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]