SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000004078 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000004078
Domain Number 1 Region: 41-85
Classification Level Classification E-value
Superfamily LysM domain 0.0000000235
Family LysM domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000004078   Gene: ENSOCUG00000004722   Transcript: ENSOCUT00000004720
Sequence length 220
Comment pep:known chromosome:OryCun2.0:13:41027661:41038680:1 gene:ENSOCUG00000004722 transcript:ENSOCUT00000004720 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPSRQPPVGGSGLLQGSRARSYGSLVQSACSPVRERRLEHQLEPGDTLAGLALKYGVT
MEQIKRANRLYTNDSIFLKKTLYIPILTEPRDLFNGLDSEEEKDGEEDVHPNKDDVWPHP
AERKKQETGAGRANGEVLPTPTQDLSASDFLKKLDSQISLSKKAAAQKLKTRESRVPGED
AGLHLNSPRMQQRAVLGPVPLTRTSRTQTLRDQEDEIFKL
Download sequence
Identical sequences B7NZC8
NP_001164768.1.1745 XP_008262239.1.1745 XP_008262240.1.1745 ENSOCUP00000004078 9986.ENSOCUP00000004078 ENSOCUP00000004078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]