SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000004198 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOCUP00000004198
Domain Number - Region: 174-254
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0324
Family PYP-like 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000004198   Gene: ENSOCUG00000004855   Transcript: ENSOCUT00000004854
Sequence length 608
Comment pep:known_by_projection chromosome:OryCun2.0:6:9623923:9668299:-1 gene:ENSOCUG00000004855 transcript:ENSOCUT00000004854 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFSAALIAAAADLRPQFPSGSRRRDVTPNHRRKGYEEADGETDTKDALREPLGQWLPPE
RRREKCVRLGEHAREPGTGTNDQLVAFLSRYRDMNFLKSHGRDNARFIRKQGLDRLFLEC
DAHMWRLGDRRIPEGIAVDGGSDWFLLNRKFVEYVTFSTDDLVTKMKQFYSYTLLPAESF
FHTVLENSPHCDTMVDNNLRITNWNRKLGCKCQYKHIVDWCGCSPNDFKPQDFHRFQQTA
RPTFFARKFEAVVNQEIIGQLDYYLYGNYPAGTPGLRSYWENVYDEPDGVQSLSDVALTL
YHSFARLGLRRAEASLHTDGENSCRYYPMGHPASVHLYFLADRFQGFLVKHHATNLAVSK
LETLETWVMPKKVFKVASPPSDFGRLQFSEVGTDWDAKERLFRNFGGLLGPLDEPVGMQK
WGKGPNVTVTVVWVDPVNIIAATYDILIESTAEFTHYKPPLNLPLRPGVWTVKILHHWVP
VAETRFLVAPLTFSNRQPIKPEETLKLHNGPPRSAYMEQSFQSLNPVLSLPISPAQVEQA
GRNAAATGTALEGWLDSLVGSMWAAMDVCSTGPTACPVMQSCSHTAWSSLSPDPKSELGA
VKPDGRLR
Download sequence
Identical sequences G1SMN5
ENSOCUP00000004198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]