SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000004215 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000004215
Domain Number 1 Region: 298-362
Classification Level Classification E-value
Superfamily RILP dimerisation region 6.54e-20
Family RILP dimerisation region 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000004215   Gene: ENSOCUG00000004876   Transcript: ENSOCUT00000004874
Sequence length 406
Comment pep:known_by_projection scaffold:OryCun2.0:GL018923:224177:256995:-1 gene:ENSOCUG00000004876 transcript:ENSOCUT00000004874 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELERGSEPAAESALEKNVAELTVMDVYDIASLVGHEFERVVDQHGCEAIARLMPKVVRV
LEILEVLVSRHHVAPELDELRLELDRLRVERMDRIEKERKHQKELELVEDVWRGEAQDLL
SQIAQLQEENKQLMTNLSHKDVSFSEEELQKHEGMSERERQVMKKLKEVVDKQRDEIRAK
DRELGLKNEDVEALQQQQTRLMKINHDLRHRVTVVEAQGKALIEQKVELEADLQTKEQEM
GSLRAELGRLRERLRGELSPDADAEEEPEQAELGGQECVSDAEKAAMDLKDPNRPRFTLQ
ELRDVLHERNELKSKVFLLQEELAYYKSEEMEEENRIPQPPPVAHPRLSPQPESGIKRLF
SFFSRDKKRLANAQRSVPIHESFGQWASTQRDDGYTEQGQEALQHL
Download sequence
Identical sequences G1SMP6
ENSOCUP00000004215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]