SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000004246 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000004246
Domain Number 1 Region: 310-367
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 1.33e-22
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.0000596
Further Details:      
 
Domain Number 2 Region: 2-41
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.0000000000000497
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00017
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000004246
Domain Number - Region: 270-316
Classification Level Classification E-value
Superfamily ARM repeat 0.00466
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000004246   Gene: ENSOCUG00000004907   Transcript: ENSOCUT00000004906
Sequence length 367
Comment pep:known_by_projection chromosome:OryCun2.0:20:24114900:24148717:1 gene:ENSOCUG00000004907 transcript:ENSOCUT00000004906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMQSRAVDGFHSEEQQLLLQV
QQQHQPQQQQHHHHHHHQQAQPQQTVPQQAQTQQVLIPASQQATAPQVIVPDSKLIQHMN
ASNMQSAAATAATLALPAGVTPVQQILTNSGQLLQVVRAANGAQYIFQPQQSVVLQQQVI
PQMQPGGVQAPVIQQVLAPLPGGISPQTGVIIQPQQILFTGNKTQVIPTTVAAPTPAQAQ
ITATGQQQPQAQPAQQQAPLVLQVDGTGDTSSEEDEDEEEDYDDDEEEDKEKDGAEDGQV
EEEPLNSEDDVSDEEGQELFDTENVVVCQYDKIHRSKNKWKFHLKDGIMNLNGRDYIFSK
AIGDAEW
Download sequence
Identical sequences G1SMS4
ENSOCUP00000025690 9986.ENSOCUP00000004246 ENSOCUP00000004246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]