SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000004258 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000004258
Domain Number 1 Region: 44-283
Classification Level Classification E-value
Superfamily PLP-binding barrel 5.98e-72
Family Alanine racemase-like, N-terminal domain 0.000000000856
Further Details:      
 
Domain Number 2 Region: 262-424
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 1.4e-48
Family Eukaryotic ODC-like 0.00000119
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000004258   Gene: ENSOCUG00000004925   Transcript: ENSOCUT00000004923
Sequence length 461
Comment pep:known_by_projection scaffold:OryCun2.0:GL018795:229396:235818:-1 gene:ENSOCUG00000004925 transcript:ENSOCUT00000004923 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSSSHEEFDCHFLDEGFTARDILEQKINEVSASDDKDAFYVADLGDVLKKHLRWLKALP
RVTPFYAVKCNDSRAIIKTLATIGTGFDCASKTEIQLVQGLGVPPERIIYANPCKQVSQI
KYAASSGVQMMTFDSEVELMKVARAHPKARLVLRIATDDSKAVCRLSVKFGATLKTSRLL
LERAKELNIDVIGVSFHVGSGCTDPETFVQALSDARCVFDMGAEVGFHMHLLDIGGGFPG
SEDAKLKFEEITSVINPALDKYFPSDSGVRIIAEPGRYYVASAFTLAVNIIAKKLVLKEQ
TGSDDEDEASERTFMYYVNDGVYGSFNCILYDHAHVKPLLQKRPKPDEQYYPASIWGPTC
DGLDRIVARCDLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPTIHYVMSGPMWQLMQQV
RNRDFPPEVEEPDVGALPVSCAQESGMKRHPATCASASINV
Download sequence
Identical sequences G1SMT5
ENSOCUP00000004258 ENSOCUP00000004258 XP_002722435.1.1745 9986.ENSOCUP00000004258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]