SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000004325 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000004325
Domain Number 1 Region: 474-723
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.31e-59
Family Eukaryotic proteases 0.000037
Further Details:      
 
Domain Number 2 Region: 381-474
Classification Level Classification E-value
Superfamily Kringle-like 8.94e-34
Family Kringle modules 0.00011
Further Details:      
 
Domain Number 3 Region: 204-287
Classification Level Classification E-value
Superfamily Kringle-like 5.56e-33
Family Kringle modules 0.00014
Further Details:      
 
Domain Number 4 Region: 112-203
Classification Level Classification E-value
Superfamily Kringle-like 6.28e-31
Family Kringle modules 0.00031
Further Details:      
 
Domain Number 5 Region: 295-379
Classification Level Classification E-value
Superfamily Kringle-like 5.07e-30
Family Kringle modules 0.00017
Further Details:      
 
Domain Number 6 Region: 34-121
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 2.55e-17
Family Hairpin loop containing domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000004325   Gene: ENSOCUG00000004997   Transcript: ENSOCUT00000004996
Sequence length 725
Comment pep:known_by_projection chromosome:OryCun2.0:9:17195811:17204240:-1 gene:ENSOCUG00000004997 transcript:ENSOCUT00000004996 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLWWVTVQPPAGRMRWLPLLLLLTWCSGAPGQRSALNDFQVLRGTELQHLLHAVVPGPW
QEDVANAEECAGRCQPLLDCRAFHYNVSSHGCQLLPWTQNSPYTRLQQSGRCDLFQKKDY
VRTCIMDNGVGYRGTVATTASGLPCQAWSHRFPNDHKYTPTLRNGLEENFCRNPDRDPGG
PWCYTTDPAVRFQTCGIKSCREAACVWCNGEDYRGAVDRTESGRECQRWDLQHPHTHPFE
PGKFLDQGLDDNYCRNPDGSERPWCYTTDPKLEREFCDLPRCGPEAQPRPQATTLNCFRG
KGENYRGTVNATAAGVPCQRWDAQSPHQHHFEPAKYECKDLRENFCRNPDGSEAPWCFTT
RPGMRVAFCYQIPRCADDVRPEGCYHGVGEHYRGRVSKTRKGIPCQHWSAETPHKPQFTP
TSAPQAQLEENFCRNPDGDSHGPWCYTTDPGTPFDYCALRRCDDDQPPSILDPPDQVLFE
KCGKRMDRLDQRRSKLRVVGGQPGNSPWTVSLRNRQGQHFCGGSLVKEQWVLTARQCFSS
CHVPLVGYEVWLGTLFQNPQPGEPGLQRVPVAKMVCGPSGSQLVLLKLERPVTLNQRVAL
ICLPPEQYVVPPGTKCEIAGWGGTQGTGDDTVLNVASLNVISNQECNVKHRGRVRESEMC
TEGLLAPVGACEGDYGGPLACFTHDCWVLEGIIIPNRVCARPLWPAVFMRVSVFVDWIHK
VMRLD
Download sequence
Identical sequences G1SMZ3
ENSOCUP00000004325 XP_008258874.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]