SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000004359 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000004359
Domain Number 1 Region: 77-290
Classification Level Classification E-value
Superfamily FKBP-like 1.26e-28
Family FKBP immunophilin/proline isomerase 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000004359   Gene: ENSOCUG00000005028   Transcript: ENSOCUT00000005032
Sequence length 652
Comment pep:known_by_projection chromosome:OryCun2.0:1:126038:162795:1 gene:ENSOCUG00000005028 transcript:ENSOCUT00000005032 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFGAGDEDDTDFLSPTGGTRLASLFGLDQAAAGHGNEFFQYTAPKQPKKGHGTATAGNQA
TPKTAPSTTGTSTLLVATAVHAYRYTNGQYVKQGKFGAAVLGNHTAKEYKILLYISQQQP
VTVARIHRNFELMVRPNNYSTFYDDQRQNWSIMFESEKNAVEFNKQVCIAKCNSTPSLDA
VLSQDLVVAEGPAIEVGDSLEVAYTGWFFQNNALGQVFDSTANKDKLLRLKLGSGKVIKG
WEDGMLGMTKGGKRLLFIPPACAAGSEGVIGWTQSMDSILVFEVEVRRVKFARDSGSDGH
SISSRDSAAPSPIPGVDGLSADPAVSLPTSVPFKSGEPALRSKSNSLSEQLSINTSSDAV
KAKLISRMAKMGQPMLPILPLQLDSNDSETEDANALRGPGQPVVTPSIQPPPQPAHPVLP
QMTSQAPQSSVSGLHAPSAALMQVASLDSHSAVPGNAQSFQPYAGMQAYAYPPASAVTSQ
LQPVRPLYPAPLSQAPHFQGSGDMAAFLMTEARQHNTEIRMAVGKVADKVDHLMTKVEEL
QKHNAGNPALIPSMSVTMETSMIMGNIQRIIQENERLKQEILEKSSRIEEQNDKISELIE
RNQRYVEQSNLMMEKRNNSLQTATENTQARVLHAEKEKKIPIMPDKEHLALH
Download sequence
Identical sequences G1SN26
ENSOCUP00000004359 ENSOCUP00000004359 9986.ENSOCUP00000004359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]