SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000004364 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000004364
Domain Number 1 Region: 5-225
Classification Level Classification E-value
Superfamily Carbonic anhydrase 4.32e-82
Family Carbonic anhydrase 0.00000000583
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000004364   Gene: ENSOCUG00000005039   Transcript: ENSOCUT00000005038
Sequence length 227
Comment pep:known_by_projection chromosome:OryCun2.0:3:100977975:100991288:-1 gene:ENSOCUG00000005039 transcript:ENSOCUT00000005038 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSDWAYDGQNGPEHWSKLYPIANGNKQSPVDIKSSEVKHDTSLKPFSVSYNPASAKEI
INVGHSFHVNFEDDSQSVLKGGPLSDNYRLSQFHFHWGKTDDYGSEHTVDGAKFSAELHL
VHWNSGKYPNIADSVSKADGLAIVAVFLKVGQANPKLQKVLDALSAVKTKGKKASFTNFD
PSTLLPPSLDYWTYSGSLTHPPLHESVTWLICKDSISISSEQVEYHR
Download sequence
Identical sequences G1SN31
ENSOCUP00000004364 9986.ENSOCUP00000004364 ENSOCUP00000004364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]