SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000004403 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000004403
Domain Number 1 Region: 118-237
Classification Level Classification E-value
Superfamily Cgl1923-like 0.0000000405
Family Cgl1923-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000004403   Gene: ENSOCUG00000005086   Transcript: ENSOCUT00000005083
Sequence length 375
Comment pep:known_by_projection chromosome:OryCun2.0:9:49414261:49438288:-1 gene:ENSOCUG00000005086 transcript:ENSOCUT00000005083 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSACRATFSQARTPQPLLAPSPGLARVSQQSSPFPFPVLAAASFLPPARQGTGRTLRTP
RRGTPRSRLRLWVLGTGPPGTAPCSGFRRPAAAVFPGLRSTPCSGRAGTMFIPCGETFPD
LSGFTLLMPAVSVGNVGQLAIDLIISTLDMCKIGYFYTDCLVPIVGNNPYATANENAAEL
STNAEVYSLPSKKLVVLQLRSIFIKYKSKSFCEKLLCWVENSGCTRVIVLSSSHSYHRND
KQLCSTPFRYLLTPSMQKTVQNKIKSLNWQEMEKSPCIPEIEDSDLCVRVPGGGITKLLY
DESCSKDIQMAVLLKFVSEGDNIPDALGLVEYLNEWLQIIKPHVQGDDPTASTLPWKIPS
SWRLLFGSGLPPALF
Download sequence
Identical sequences G1SN64
ENSOCUP00000004403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]