SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000004501 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000004501
Domain Number 1 Region: 43-229
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 1.87e-38
Family PaaI/YdiI-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000004501   Gene: ENSOCUG00000005194   Transcript: ENSOCUT00000005194
Sequence length 239
Comment pep:known_by_projection chromosome:OryCun2.0:13:40286174:40306939:1 gene:ENSOCUG00000005194 transcript:ENSOCUT00000005194 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRSCAARLRTLGAVPGPARLTLVPAPYSSPVLRSFSSEKATQKDYSLPNPSWTKDIRLL
YDQFMKKCEDGSWKRLPSYKCKSTQRVQNFRNLFLDTKFVEEQTPKAQIFTRSLEEGLGF
EYVMFHNEAEKRVVCVFQGGPHLQGNHGYVHGGAIATMIDITAGTCAVLTGGYAMTANLN
INFRRPIPLCSVVVINSQIDKIEGRKYFISCDIRSVDEKTLYSEATTFLVKVYLPKSTE
Download sequence
Identical sequences G1SNE5
ENSOCUP00000004501 ENSOCUP00000004501 9986.ENSOCUP00000004501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]