SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000004566 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000004566
Domain Number 1 Region: 6-416
Classification Level Classification E-value
Superfamily Phosphoglycerate kinase 3.77e-168
Family Phosphoglycerate kinase 0.00000000000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000004566   Gene: ENSOCUG00000005270   Transcript: ENSOCUT00000005267
Sequence length 417
Comment pep:known_by_projection chromosome:OryCun2.0:12:39006461:39007714:-1 gene:ENSOCUG00000005270 transcript:ENSOCUT00000005267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLSKKLTLDKVDVKGKRVIMRVDYNVPMKKNQITNNQRIKASIPSIKYCLDNGAKAVIL
MSHLGRPDGIPMPDKYSLEPVASELKSLLGKDVLFLKDCVGSEVEKACANPAPGSVILLE
NLRFHVEEEGKGQDASGKKLKAEPHEIEAFRASLSKLGDVYVNDAFGTAHRAHSSMVGVN
LPQKASGFLMKKELEYFAKALENPERPFLAILGGAKVADKIQLIKNMLDKVNEMIIGGGM
AFTFLKVLNNMEIGASLFDEEGAKIVKDIMAKADKNGVKITFPVDFVTADKFDENANVGQ
ATVESGIPSGWMALDCGPESSKKFAQVVAQAKLIVWNGPVGVFEWDSFASGTKALMDEIV
KATSKGCITVIGGGDTATCCAKWNTEGKVSHVSTGGGASLELLEGKILPGVEALSNL
Download sequence
Identical sequences G1SNJ9
ENSOCUP00000004566 ENSOCUP00000004566 9986.ENSOCUP00000004566 XP_002714537.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]